WP_004191885.1 has 67 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-25 73.2 6.7 8.4e-25 72.9 6.7 1.1 1 WP_004191885.1
Domain annotation for each sequence (and alignments):
>> WP_004191885.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.9 6.7 8.4e-25 8.4e-25 1 55 [. 5 59 .. 5 60 .. 0.97
Alignments for each domain:
== domain 1 score: 72.9 bits; conditional E-value: 8.4e-25
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllg 55
++++++ yvp+++++++++ ++t+l++rlla +glyr vWhp+Lf+++l+vc++g
WP_004191885.1 5 DLAILDAYVPTVVLMFVIGAFATWLIDRLLAYTGLYRVVWHPSLFRASLLVCICG 59
689**************************************************98 PP
Or compare WP_004191885.1 to CDD or PaperBLAST