reanno::pseudo13_GW456_L13:PfGW456L13_506 has 69 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-25 74.8 10.9 2.6e-25 74.6 10.9 1.1 1 reanno::pseudo13_GW456_L13:PfGW456L13_506
Domain annotation for each sequence (and alignments):
>> reanno::pseudo13_GW456_L13:PfGW456L13_506
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.6 10.9 2.6e-25 2.6e-25 1 56 [] 4 59 .. 4 59 .. 0.98
Alignments for each domain:
== domain 1 score: 74.6 bits; conditional E-value: 2.6e-25
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
++dl Gv++p+llvl+ + +vl+ll++ +l+rl++yrlvWh+aLf++al+++llg+
reanno::pseudo13_GW456_L13:PfGW456L13_506 4 DLDLSGVFLPTLLVLMGITYVLYLLVHGVLTRLHFYRLVWHRALFNVALYALLLGA 59
689***************************************************96 PP
Or compare reanno::pseudo13_GW456_L13:PfGW456L13_506 to CDD or PaperBLAST