reanno::pseudo6_N2E2:Pf6N2E2_2878 has 68 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-22 64.6 9.6 4.2e-22 64.3 9.6 1.1 1 reanno::pseudo6_N2E2:Pf6N2E2_2878
Domain annotation for each sequence (and alignments):
>> reanno::pseudo6_N2E2:Pf6N2E2_2878
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 64.3 9.6 4.2e-22 4.2e-22 1 55 [. 5 59 .. 5 60 .. 0.98
Alignments for each domain:
== domain 1 score: 64.3 bits; conditional E-value: 4.2e-22
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllg 55
E+++gGv+++p+l++++lAl++t +lr+ll+ + r++Wh aLfd al+vc+l
reanno::pseudo6_N2E2:Pf6N2E2_2878 5 EWSIGGVLLSPFLIYVVLALLVTGALRLLLSLMPAGRWIWHEALFDCALYVCVLT 59
899**************************************************96 PP
Or compare reanno::pseudo6_N2E2:Pf6N2E2_2878 to CDD or PaperBLAST