NP_080779.2 has 104 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-26 78.7 3.7 1.8e-26 78.7 3.7 1.7 2 NP_080779.2
Domain annotation for each sequence (and alignments):
>> NP_080779.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.6 0.1 0.21 0.21 32 37 .. 36 41 .. 33 46 .. 0.77
2 ! 78.7 3.7 1.8e-26 1.8e-26 4 50 .] 58 104 .] 55 104 .] 0.94
Alignments for each domain:
== domain 1 score: -1.6 bits; conditional E-value: 0.21
DUF1674 32 gpEPtR 37
+pEP +
NP_080779.2 36 KPEPAK 41
788876 PP
== domain 2 score: 78.7 bits; conditional E-value: 1.8e-26
DUF1674 4 erraaaakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50
e + ++++p ++f++dvnp t+E gGpkgpEPtRygDWerkGr++DF
NP_080779.2 58 EDSPEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF 104
56678999*************************************** PP
Or compare NP_080779.2 to CDD or PaperBLAST