NP_652574.3 has 126 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.8e-25 73.1 2.9 9.8e-25 73.1 2.9 1.8 2 NP_652574.3
Domain annotation for each sequence (and alignments):
>> NP_652574.3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.6 0.1 0.21 0.21 10 10 .. 37 37 .. 20 54 .. 0.54
2 ! 73.1 2.9 9.8e-25 9.8e-25 5 50 .] 81 126 .] 77 126 .] 0.97
Alignments for each domain:
== domain 1 score: -1.6 bits; conditional E-value: 0.21
DUF1674 10 a 10
+
NP_652574.3 37 E 37
1 PP
== domain 2 score: 73.1 bits; conditional E-value: 9.8e-25
DUF1674 5 rraaaakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50
++a +++p k+ ++++np tgEigG gpEPtRygDWerkGrv+DF
NP_652574.3 81 HPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
99******************************************** PP
Or compare NP_652574.3 to CDD or PaperBLAST