NP_660310.2 has 108 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-26 78.7 3.6 2.7e-26 78.1 3.6 1.3 1 NP_660310.2
Domain annotation for each sequence (and alignments):
>> NP_660310.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.1 3.6 2.7e-26 2.7e-26 3 50 .] 61 108 .] 59 108 .] 0.95
Alignments for each domain:
== domain 1 score: 78.1 bits; conditional E-value: 2.7e-26
DUF1674 3 eerraaaakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50
e ++ +++p ++f++dvnp t+E gGp+gpEPtRygDWerkGr++DF
NP_660310.2 61 PEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108
5678899***************************************** PP
Or compare NP_660310.2 to CDD or PaperBLAST