SwissProt::Q8BTE0 has 104 amino acids
Query: DUF1674 [M=50] Accession: PF07896.16 Description: Protein of unknown function (DUF1674) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-26 78.7 3.7 1.8e-26 78.7 3.7 1.7 2 SwissProt::Q8BTE0 Domain annotation for each sequence (and alignments): >> SwissProt::Q8BTE0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.1 0.21 0.21 32 37 .. 36 41 .. 33 46 .. 0.77 2 ! 78.7 3.7 1.8e-26 1.8e-26 4 50 .] 58 104 .] 55 104 .] 0.94 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.21 DUF1674 32 gpEPtR 37 +pEP + SwissProt::Q8BTE0 36 KPEPAK 41 788876 PP == domain 2 score: 78.7 bits; conditional E-value: 1.8e-26 DUF1674 4 erraaaakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50 e + ++++p ++f++dvnp t+E gGpkgpEPtRygDWerkGr++DF SwissProt::Q8BTE0 58 EDSPEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF 104 56678999*************************************** PP
Or compare SwissProt::Q8BTE0 to CDD or PaperBLAST