Q8NC96 has 275 amino acids
Query: DUF1681 [M=158] Accession: PF07933.18 Description: Protein of unknown function (DUF1681) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-65 205.0 0.0 3.4e-65 204.7 0.0 1.1 1 Q8NC96 Domain annotation for each sequence (and alignments): >> Q8NC96 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 204.7 0.0 3.4e-65 3.4e-65 1 157 [. 7 163 .. 7 164 .. 0.95 Alignments for each domain: == domain 1 score: 204.7 bits; conditional E-value: 3.4e-65 DUF1681 1 iervllvakevhvYkippltsskgyraadWtakepiwtgrlrvvekgkkvdikLedkktgelfaaapve.tkeaavekvlDSsRyFvlrvedekgrkaflGi 101 +e+vl+v+++v+vY+ipp++s++gyra+dW+ ++p wtgrlr+++kgk++ ikLedk +gelfa+apve ave+v+DSsRyFv+r++d +gr+af+Gi Q8NC96 7 YESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFAQAPVEqYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGI 108 799*****************************************************************9755689*************************** PP DUF1681 102 gFeeRsdafdfnvalqdaekrlkkekeaeekekeeeekkekkdysLkeGetikinl 157 gF++R dafdfnv+lqd++k++k+e+e ++ e++e +++ k d+ +keG+tik+ + Q8NC96 109 GFTDRGDAFDFNVSLQDHFKWVKQESEISK-ESQEMDARPKLDLGFKEGQTIKLCI 163 ****************************97.5566666669***********9977 PP
Or compare Q8NC96 to CDD or PaperBLAST