PaperBLAST – Find papers about a protein or its homologs

 

Align NP_060370.1 to PF08213 (COX24_C)

NP_060370.1 has 199 amino acids

Query:       COX24_C  [M=33]
Accession:   PF08213.15
Description: Mitochondrial mRNA-processing protein COX24, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.2e-17   47.4  14.4    7.2e-17   47.4  14.4    2.0  2  NP_060370.1  


Domain annotation for each sequence (and alignments):
>> NP_060370.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   47.4  14.4   7.2e-17   7.2e-17       1      32 [.     127     158 ..     127     159 .. 0.96
   2 ?   -3.5   3.0      0.57      0.57      18      23 ..     164     169 ..     161     175 .. 0.49

  Alignments for each domain:
  == domain 1  score: 47.4 bits;  conditional E-value: 7.2e-17
      COX24_C   1 adSVlrKRrkKMkKHKyKKlrKrtRalrrrlg 32 
                  +++Vl++Rr+KM++HKy+Kl K+tR+lrr+++
  NP_060370.1 127 CKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQ 158
                  89****************************85 PP

  == domain 2  score: -3.5 bits;  conditional E-value: 0.57
      COX24_C  18 KKlrKr 23 
                  +K  K 
  NP_060370.1 164 RKQIKF 169
                  444444 PP



Or compare NP_060370.1 to CDD or PaperBLAST