Q0VCJ1 has 199 amino acids
Query: COX24_C [M=33] Accession: PF08213.15 Description: Mitochondrial mRNA-processing protein COX24, C-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-16 46.9 16.1 1e-16 46.9 16.1 2.3 2 Q0VCJ1 Domain annotation for each sequence (and alignments): >> Q0VCJ1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.9 16.1 1e-16 1e-16 1 32 [. 127 158 .. 127 159 .. 0.95 2 ? 0.2 2.2 0.04 0.04 18 29 .. 164 175 .. 163 177 .. 0.66 Alignments for each domain: == domain 1 score: 46.9 bits; conditional E-value: 1e-16 COX24_C 1 adSVlrKRrkKMkKHKyKKlrKrtRalrrrlg 32 + +Vl++Rr+KM++HKy+Kl KrtR+lrr+++ Q0VCJ1 127 CRNVLKIRRRKMNHHKYRKLVKRTRFLRRKVR 158 789***************************86 PP == domain 2 score: 0.2 bits; conditional E-value: 0.04 COX24_C 18 KKlrKrtRalrr 29 +K +K +R lrr Q0VCJ1 164 RKQMKFERDLRR 175 566666666665 PP
Or compare Q0VCJ1 to CDD or PaperBLAST