SwissProt::Q9P7H5 has 175 amino acids
Query: COX24_C [M=33]
Accession: PF08213.15
Description: Mitochondrial mRNA-processing protein COX24, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.1e-17 47.2 21.5 1.1e-16 46.8 21.5 1.2 1 SwissProt::Q9P7H5
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9P7H5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 46.8 21.5 1.1e-16 1.1e-16 2 33 .] 144 175 .] 143 175 .] 0.97
Alignments for each domain:
== domain 1 score: 46.8 bits; conditional E-value: 1.1e-16
COX24_C 2 dSVlrKRrkKMkKHKyKKlrKrtRalrrrlgk 33
+SV+rKR++KM+KHK+KK+++r+Ralr+rlgk
SwissProt::Q9P7H5 144 TSVKRKRKLKMNKHKFKKRLRRQRALRKRLGK 175
7*****************************98 PP
Or compare SwissProt::Q9P7H5 to CDD or PaperBLAST