PaperBLAST – Find papers about a protein or its homologs

 

Align XP_965679.1 to PF08213 (COX24_C)

XP_965679.1 has 344 amino acids

Query:       COX24_C  [M=33]
Accession:   PF08213.15
Description: Mitochondrial mRNA-processing protein COX24, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.8e-12   32.3  19.5    3.8e-12   32.3  19.5    2.2  2  XP_965679.1  


Domain annotation for each sequence (and alignments):
>> XP_965679.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.5   3.3      0.59      0.59       5      11 ..      83      89 ..      82      89 .. 0.56
   2 !   32.3  19.5   3.8e-12   3.8e-12       1      32 [.     311     342 ..     311     343 .. 0.95

  Alignments for each domain:
  == domain 1  score: -3.5 bits;  conditional E-value: 0.59
      COX24_C  5 lrKRrkK 11
                 +rKR+ K
  XP_965679.1 83 KRKRKAK 89
                 4666655 PP

  == domain 2  score: 32.3 bits;  conditional E-value: 3.8e-12
      COX24_C   1 adSVlrKRrkKMkKHKyKKlrKrtRalrrrlg 32 
                  a+SV+r++++K+kK+KyKKl++rtR++rr+++
  XP_965679.1 311 AISVRRQKKLKIKKKKYKKLMRRTRNERRKQD 342
                  68****************************97 PP



Or compare XP_965679.1 to CDD or PaperBLAST