PaperBLAST – Find papers about a protein or its homologs

 

Align XP_754780.1 to PF08508 (DUF1746)

XP_754780.1 has 331 amino acids

Query:       DUF1746  [M=116]
Accession:   PF08508.14
Description: Fungal domain of unknown function (DUF1746)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-48  150.1   3.3    2.2e-48  149.6   3.3    1.2  1  XP_754780.1  


Domain annotation for each sequence (and alignments):
>> XP_754780.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.6   3.3   2.2e-48   2.2e-48       1     116 []      60     173 ..      60     173 .. 0.97

  Alignments for each domain:
  == domain 1  score: 149.6 bits;  conditional E-value: 2.2e-48
      DUF1746   1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesftellpaekpllvaillsnllclllhllfslpsageatrgylhggliidFiGqkapts 98 
                  +Ld+l+y++l++lYymDcs++++++Raivql+f+tpk+++f    ++++p+++ai++sn++c+++h +f+ p+a+eatrgylhggl+idFiGqkap+s
  XP_754780.1  60 DLDILIYCELSALYYMDCSVILFAIRAIVQLIFFTPKAPPFDP--TRNQPFIGAIFVSNIFCMIFHNFFTHPEASEATRGYLHGGLLIDFIGQKAPIS 155
                  69*************************************8755..489************************************************** PP

      DUF1746  99 rlellllDllilllqllm 116
                   ++l+llD+l+l+l+l+m
  XP_754780.1 156 LFRLFLLDFLVLILDLVM 173
                  *****************9 PP



Or compare XP_754780.1 to CDD or PaperBLAST