XP_956050.1 has 275 amino acids
Query: DUF1751 [M=99]
Accession: PF08551.14
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-10 27.4 0.1 3.5e-10 26.7 0.1 1.4 1 XP_956050.1
Domain annotation for each sequence (and alignments):
>> XP_956050.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.7 0.1 3.5e-10 3.5e-10 8 69 .. 46 106 .. 39 134 .. 0.85
Alignments for each domain:
== domain 1 score: 26.7 bits; conditional E-value: 3.5e-10
DUF1751 8 pwtlltasfvelnvfkvlvslltLllggkylErlWgskEllkFilvvnvitnllvvlltlll 69
w +lt +++ +n +vl+ +++L+++ +++Er+Wgs+ ++ Fil+ +++t ++ ++ +++
XP_956050.1 46 LWRMLTYQLCYTNSSEVLFGAMSLYHM-RMVERFWGSRKYASFILLAALFTAIIPPIFLTVV 106
599*********************987.9***********************9976665554 PP
Or compare XP_956050.1 to CDD or PaperBLAST