VIMSS6586494 has 240 amino acids
Query: DUF1771 [M=64] Accession: PF08590.14 Description: Domain of unknown function (DUF1771) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-24 72.0 8.2 3.9e-24 71.1 8.2 1.5 1 VIMSS6586494 Domain annotation for each sequence (and alignments): >> VIMSS6586494 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.1 8.2 3.9e-24 3.9e-24 1 64 [] 26 89 .. 26 89 .. 1.00 Alignments for each domain: == domain 1 score: 71.1 bits; conditional E-value: 3.9e-24 DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64 Y+rlR++A+++++kr +l+++++ Ay++Gd+++A+else++k++ + ae++n qAae++f e+N VIMSS6586494 26 YQRLRRLADEAYKKRDQLSHESQTAYQQGDKKLAHELSEKSKAQLKTAEDFNMQAAEYVFVENN 89 9**************************************************************9 PP
Or compare VIMSS6586494 to CDD or PaperBLAST