XP_012050514.1 has 313 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-25 76.1 6.4 1e-25 76.1 6.4 1.9 2 XP_012050514.1
Domain annotation for each sequence (and alignments):
>> XP_012050514.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.9 0.3 1 1 40 45 .. 72 77 .. 65 81 .. 0.57
2 ! 76.1 6.4 1e-25 1e-25 1 64 [] 138 201 .. 138 201 .. 0.99
Alignments for each domain:
== domain 1 score: -3.9 bits; conditional E-value: 1
DUF1771 40 eGkehg 45
++++h+
XP_012050514.1 72 QAQQHQ 77
334443 PP
== domain 2 score: 76.1 bits; conditional E-value: 1e-25
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64
Y +lR++Ark++++++++f+++++Ay++Gdga+A+els +Gk+h++ ++++ qA+++If+e+N
XP_012050514.1 138 YVDLRNKARKEGDEAHRCFAASQAAYQAGDGAKAHELSVQGKAHQRTQDQLDDQASAWIFNENN 201
899************************************************************9 PP
Or compare XP_012050514.1 to CDD or PaperBLAST