XP_774833.1 has 308 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-26 76.7 7.0 1.5e-25 75.6 7.0 1.6 1 XP_774833.1
Domain annotation for each sequence (and alignments):
>> XP_774833.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.6 7.0 1.5e-25 1.5e-25 1 64 [] 133 196 .. 133 196 .. 0.99
Alignments for each domain:
== domain 1 score: 75.6 bits; conditional E-value: 1.5e-25
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64
Y +lR++Ark++++++++f+++++Ay++Gdga+A+els +Gk+h++ ++++ qA+++If+e+N
XP_774833.1 133 YVELRNKARKEGDEAHRCFAASQAAYQAGDGAKAHELSVQGKAHQRTQDQLDDQASAWIFNENN 196
899************************************************************9 PP
Or compare XP_774833.1 to CDD or PaperBLAST