XP_001481565.1 has 175 amino acids
Query: Anthrone_oxy [M=106] Accession: PF08592.15 Description: Anthrone oxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-29 86.6 2.1 6.5e-29 86.6 2.1 1.9 2 XP_001481565.1 Domain annotation for each sequence (and alignments): >> XP_001481565.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.1 0.1 0.1 36 69 .. 13 45 .. 6 53 .. 0.62 2 ! 86.6 2.1 6.5e-29 6.5e-29 1 106 [] 55 168 .. 55 168 .. 0.94 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.1 Anthrone_oxy 36 alllvaaAallllgivpfTllvmvplNnaLaalk 69 +l l ++Aa l+ i+ +++ + l ++L++++ XP_001481565.1 13 ILGL-TGAAWLSGNIFSLSFIPNPALIQTLHEKQ 45 3444.44666887788888887777777777774 PP == domain 2 score: 86.6 bits; conditional E-value: 6.5e-29 Anthrone_oxy 1 wallfkrgkavlpalalaaalaylyla.........rrarrsaaalllvaaAallllgivpfTllvmvplNnaLaalkeaaekeeaeaaevrell 86 wa +++ gk + p++a+a+a++++yl+ + ++++++ l+ a+++ll++givp+T+++m+ +N++L+a+ ++ ++ea+++ev++l+ XP_001481565.1 55 WAGIYSAGKTQNPPIAAATAAVFFYLSwsvrdgtalSLVAAPNSSFLY-AVSGLLTVGIVPYTFAFMMGTNRSLEAKVGSKDDSEATRTEVESLM 148 999*********************9999*******9777788889999.77**************************9777888899******** PP Anthrone_oxy 87 drWgrlnlvRtvlslaaavl 106 +rWg ln+vR +++l++av+ XP_001481565.1 149 ERWGVLNAVRGAFPLVGAVV 168 ******************96 PP
Or compare XP_001481565.1 to CDD or PaperBLAST