PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001481565.1 to PF08592 (Anthrone_oxy)

XP_001481565.1 has 175 amino acids

Query:       Anthrone_oxy  [M=106]
Accession:   PF08592.15
Description: Anthrone oxygenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.5e-29   86.6   2.1    6.5e-29   86.6   2.1    1.9  2  XP_001481565.1  


Domain annotation for each sequence (and alignments):
>> XP_001481565.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   0.1       0.1       0.1      36      69 ..      13      45 ..       6      53 .. 0.62
   2 !   86.6   2.1   6.5e-29   6.5e-29       1     106 []      55     168 ..      55     168 .. 0.94

  Alignments for each domain:
  == domain 1  score: -0.9 bits;  conditional E-value: 0.1
    Anthrone_oxy 36 alllvaaAallllgivpfTllvmvplNnaLaalk 69
                    +l l ++Aa l+  i+  +++ +  l ++L++++
  XP_001481565.1 13 ILGL-TGAAWLSGNIFSLSFIPNPALIQTLHEKQ 45
                    3444.44666887788888887777777777774 PP

  == domain 2  score: 86.6 bits;  conditional E-value: 6.5e-29
    Anthrone_oxy   1 wallfkrgkavlpalalaaalaylyla.........rrarrsaaalllvaaAallllgivpfTllvmvplNnaLaalkeaaekeeaeaaevrell 86 
                     wa +++ gk + p++a+a+a++++yl+         +  ++++++ l+ a+++ll++givp+T+++m+ +N++L+a+  ++ ++ea+++ev++l+
  XP_001481565.1  55 WAGIYSAGKTQNPPIAAATAAVFFYLSwsvrdgtalSLVAAPNSSFLY-AVSGLLTVGIVPYTFAFMMGTNRSLEAKVGSKDDSEATRTEVESLM 148
                     999*********************9999*******9777788889999.77**************************9777888899******** PP

    Anthrone_oxy  87 drWgrlnlvRtvlslaaavl 106
                     +rWg ln+vR +++l++av+
  XP_001481565.1 149 ERWGVLNAVRGAFPLVGAVV 168
                     ******************96 PP



Or compare XP_001481565.1 to CDD or PaperBLAST