XP_751386.2 has 161 amino acids
Query: Anthrone_oxy [M=106] Accession: PF08592.15 Description: Anthrone oxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.1 2.8 2.2e-31 94.5 2.8 1.3 1 XP_751386.2 Domain annotation for each sequence (and alignments): >> XP_751386.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.5 2.8 2.2e-31 2.2e-31 1 106 [] 50 153 .. 50 153 .. 0.93 Alignments for each domain: == domain 1 score: 94.5 bits; conditional E-value: 2.2e-31 Anthrone_oxy 1 wallfkrgkavlpalalaaalaylylarrarrsaaalllvaaAallllgivpfTllvmvplNnaLaalkeaaekeeaeaaevrelldrWgrlnlvRt 97 + +l+++g++++p+la++++l+y+y+a++ r+++ + l ++Aa+ ++++vpfT+lvm p+NnaL+++ a+ ++a++ evr+ll rW++l++vR+ XP_751386.2 50 FTRLYDIGHKMMPSLAVTTCLLYGYTASSTRTTGGSGLPHIIAAVTTISMVPFTWLVMAPTNNALFRMH--ANPAAANLGEVRRLLVRWAQLHAVRS 144 789************************999999999999999**************************5..4455679******************* PP Anthrone_oxy 98 vlslaaavl 106 +++l+++vl XP_751386.2 145 LFPLMGSVL 153 ******986 PP
Or compare XP_751386.2 to CDD or PaperBLAST