PaperBLAST – Find papers about a protein or its homologs

 

Align XP_751386.2 to PF08592 (Anthrone_oxy)

XP_751386.2 has 161 amino acids

Query:       Anthrone_oxy  [M=106]
Accession:   PF08592.15
Description: Anthrone oxygenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-31   95.1   2.8    2.2e-31   94.5   2.8    1.3  1  XP_751386.2  


Domain annotation for each sequence (and alignments):
>> XP_751386.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   94.5   2.8   2.2e-31   2.2e-31       1     106 []      50     153 ..      50     153 .. 0.93

  Alignments for each domain:
  == domain 1  score: 94.5 bits;  conditional E-value: 2.2e-31
  Anthrone_oxy   1 wallfkrgkavlpalalaaalaylylarrarrsaaalllvaaAallllgivpfTllvmvplNnaLaalkeaaekeeaeaaevrelldrWgrlnlvRt 97 
                   + +l+++g++++p+la++++l+y+y+a++ r+++ + l  ++Aa+ ++++vpfT+lvm p+NnaL+++   a+ ++a++ evr+ll rW++l++vR+
   XP_751386.2  50 FTRLYDIGHKMMPSLAVTTCLLYGYTASSTRTTGGSGLPHIIAAVTTISMVPFTWLVMAPTNNALFRMH--ANPAAANLGEVRRLLVRWAQLHAVRS 144
                   789************************999999999999999**************************5..4455679******************* PP

  Anthrone_oxy  98 vlslaaavl 106
                   +++l+++vl
   XP_751386.2 145 LFPLMGSVL 153
                   ******986 PP



Or compare XP_751386.2 to CDD or PaperBLAST