A0R6J8 has 161 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-56 174.8 0.0 7.1e-56 174.7 0.0 1.0 1 A0R6J8 Domain annotation for each sequence (and alignments): >> A0R6J8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 174.7 0.0 7.1e-56 7.1e-56 2 151 .] 8 158 .. 7 158 .. 0.96 Alignments for each domain: == domain 1 score: 174.7 bits; conditional E-value: 7.1e-56 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkee..k 95 ++pla+LlGtW G G+geypti++fey eei+f h gkpfl+Y++rt d+g+plh+E+Gy+r p+ ++ve++lahptG++e++eG+++ + + A0R6J8 8 IAPLAPLLGTWAGPGAGEYPTIQSFEYLEEITFGHVGKPFLTYQQRTKARDDGRPLHAEVGYIR-VPAPDRVEWVLAHPTGITEIQEGTLTVGgdR 102 79**************************************************99**********.7*************************77556 PP THAP4_heme-bd 96 ktlelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 t++++ ++i+ t++ak+vta+ r+++++ ++L+y+++m avg+plq+hl atL+r A0R6J8 103 ITMDVKATTIGLTASAKNVTALARSFRITGDELTYTLQMGAVGQPLQHHLAATLRR 158 677777899*******************9889**********************98 PP
Or compare A0R6J8 to CDD or PaperBLAST