A1T297 has 164 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-57 177.9 0.0 8.3e-57 177.7 0.0 1.0 1 A1T297 Domain annotation for each sequence (and alignments): >> A1T297 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 177.7 0.0 8.3e-57 8.3e-57 2 151 .] 12 162 .. 11 162 .. 0.96 Alignments for each domain: == domain 1 score: 177.7 bits; conditional E-value: 8.3e-57 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkee..k 95 +++la+LlGtW GeG+geyptie+f y+eei+f h gkpfl+Y +rt+ +d+g+plh+EtGylr + +++e++lahptG++e++eG++++ + A1T297 12 VAALAPLLGTWVGEGSGEYPTIEPFGYTEEITFGHVGKPFLTYAQRTRAADDGRPLHAETGYLR-ASAPDRIEWILAHPTGITEIQEGQLTADgdG 106 789*************************************************99**********.7999*********************966678 PP THAP4_heme-bd 96 ktlelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++el s +i+r+ +akevt++ r+++l ++L+y+++maavg+plq+hlsa L+r A1T297 107 LRMELVSSSIGRSGSAKEVTDVGRSIELRGDTLTYTLRMAAVGQPLQHHLSAVLRR 162 889999**********************9889**********************98 PP
Or compare A1T297 to CDD or PaperBLAST