A5BBZ0 has 164 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-54 169.8 0.0 2.6e-54 169.6 0.0 1.0 1 A5BBZ0 Domain annotation for each sequence (and alignments): >> A5BBZ0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.6 0.0 2.6e-54 2.6e-54 2 151 .] 18 163 .. 17 163 .. 0.97 Alignments for each domain: == domain 1 score: 169.6 bits; conditional E-value: 2.6e-54 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkeekkt 97 ++pl+ LlGtW+G+Geg++pti++f+ygee+ fsh gkp+++Y++rtw+l++g+p+h+E+Gy+r +++g++e+++a++tG+ve+++G++++e+k A5BBZ0 18 IQPLSYLLGTWRGQGEGGFPTINSFSYGEELLFSHSGKPVIAYSQRTWKLSSGEPMHAESGYWR-PKPDGTIEVVIAQSTGLVEVQKGTYNAEEKL 112 79**************************************************99**********.68999*********************9999* PP THAP4_heme-bd 98 lelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++l+s+ + +a++vt+++r+++lv+g+L+y+v+ma+ ++lq+hl+a Lk+ A5BBZ0 113 VKLQSELV---GNASKVTEISRVFELVNGELSYVVQMATNLNSLQPHLKALLKK 163 ******88...69999************************************98 PP
Or compare A5BBZ0 to CDD or PaperBLAST