NP_001323382.1 has 180 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-55 173.3 0.0 2.2e-55 173.1 0.0 1.0 1 NP_001323382.1 Domain annotation for each sequence (and alignments): >> NP_001323382.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.1 0.0 2.2e-55 2.2e-55 2 151 .] 34 179 .. 33 179 .. 0.97 Alignments for each domain: == domain 1 score: 173.1 bits; conditional E-value: 2.2e-55 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkeekk 96 ++pl+ LlGtW+G+Gegeypti +f+ygeei+fsh gkp+++Y+++tw+l++g+p+h+E+Gy+r ++g++e+++a++tG+ve+++G+++ ++ NP_001323382.1 34 VAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPMHAESGYFR-PRPDGSIEVVIAQSTGLVEVQKGTYNVDEQ 127 589*************************************************************.68899*********************9999 PP THAP4_heme-bd 97 tlelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 +++l+sd + +a++v++++r+++lvdg+L+y+v+m+++++plq+hl+a L++ NP_001323382.1 128 SIKLKSDLV---GNASKVKEISREFELVDGKLSYVVRMSTTTNPLQPHLKAILDK 179 *******88...68999**********************************9987 PP
Or compare NP_001323382.1 to CDD or PaperBLAST