Q1EP49 has 191 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-51 159.8 0.0 3.3e-51 159.5 0.0 1.1 1 Q1EP49 Domain annotation for each sequence (and alignments): >> Q1EP49 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 159.5 0.0 3.3e-51 3.3e-51 2 151 .] 19 162 .. 18 162 .. 0.96 Alignments for each domain: == domain 1 score: 159.5 bits; conditional E-value: 3.3e-51 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkeekkt 97 ++pl+ LlG+W+G+Geg++pti++f+ygee+ fsh gkp+++Y+++tw+l +g+p+h+E+Gy+r +++g++e+++a++tG++e+++G++++e++ Q1EP49 19 IAPLSYLLGRWRGQGEGGFPTINSFAYGEELIFSHSGKPVIAYSQKTWKLASGEPMHAESGYWR-PKPDGSIEVVIAQSTGLAEVQKGTYDAENRI 113 78**************************************************99**********.68999*********************9999* PP THAP4_heme-bd 98 lelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++l+s+ ++ ++ ++++r++++v+g+L+y+vema+v t+lq+hl+a Lk+ Q1EP49 114 VTLQSELVG-----NASKEITRVFKVVNGELSYVVEMATVITSLQPHLKALLKK 162 *****9885.....55689*********************************98 PP
Or compare Q1EP49 to CDD or PaperBLAST