VIMSS10086416 has 166 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-55 173.7 0.0 1.7e-55 173.5 0.0 1.0 1 VIMSS10086416 Domain annotation for each sequence (and alignments): >> VIMSS10086416 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.5 0.0 1.7e-55 1.7e-55 2 151 .] 20 165 .. 19 165 .. 0.97 Alignments for each domain: == domain 1 score: 173.5 bits; conditional E-value: 1.7e-55 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkeekkt 97 ++pl+ LlGtW+G+Gegeypti +f+ygeei+fsh gkp+++Y+++tw+l++g+p+h+E+Gy+r ++g++e+++a++tG+ve+++G+++ +++ VIMSS10086416 20 VAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPMHAESGYFR-PRPDGSIEVVIAQSTGLVEVQKGTYNVDEQS 114 589*************************************************************.68899*********************9999* PP THAP4_heme-bd 98 lelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++l+sd + +a++v++++r+++lvdg+L+y+v+m+++++plq+hl+a L++ VIMSS10086416 115 IKLKSDLV---GNASKVKEISREFELVDGKLSYVVRMSTTTNPLQPHLKAILDK 165 ******88...68999**********************************9987 PP
Or compare VIMSS10086416 to CDD or PaperBLAST