VIMSS244447 has 191 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-50 155.3 0.0 7.4e-50 155.2 0.0 1.0 1 VIMSS244447 Domain annotation for each sequence (and alignments): >> VIMSS244447 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 155.2 0.0 7.4e-50 7.4e-50 1 151 [] 11 164 .. 11 164 .. 0.97 Alignments for each domain: == domain 1 score: 155.2 bits; conditional E-value: 7.4e-50 THAP4_heme-bd 1 elgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrlde....gkplhrEtGylrlepgtgevelllahptGvveleeGevk 92 +l pl +LlG W G G+ ++p+ e++++g+e++f+hdg++fl+Y+s+tw ld+ +pl++E G++r+ +++++ve+++++ +Gv+e+++Ge++ VIMSS244447 11 DLVPLVFLLGDWAGAGVHDFPGAEKCNFGQEVSFTHDGRDFLEYQSHTWVLDNdgnkVRPLESEHGFWRI-DANRKVEVTMTRDDGVIEIWYGELA 105 589**************************************************997734**********5.9999********************* PP THAP4_heme-bd 93 eekktlelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++k +++l +da+art+ ++++t++krlyg+v++dL+++ e ++ + +l++++sa+Lk+ VIMSS244447 106 DQKPQIDLVTDAVARTAASQPYTGGKRLYGYVKSDLMWVGEKQTPEVELRPYMSAHLKK 164 *********************************************************98 PP
Or compare VIMSS244447 to CDD or PaperBLAST