VIMSS34490 has 164 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-53 165.7 0.0 4.7e-53 165.5 0.0 1.0 1 VIMSS34490 Domain annotation for each sequence (and alignments): >> VIMSS34490 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 165.5 0.0 4.7e-53 4.7e-53 2 151 .] 9 162 .. 8 162 .. 0.95 Alignments for each domain: == domain 1 score: 165.5 bits; conditional E-value: 4.7e-53 THAP4_heme-bd 2 lgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkeekkt 97 l++l++LlG+W G+G+g+ypti++fey ee++f+h gkpfl+Y+++t+ + +gkplh+EtGylr + g vel+lahp+G++e+e+G+++ ++ VIMSS34490 9 LQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLR-VCRPGCVELVLAHPSGITEIEVGTYSVTGDV 103 899*************************************************************.6899**********************99888 PP THAP4_heme-bd 98 lele.....sdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 +ele +++i+ +takevta+ r+y++ ++L+y+++m+avg+plq hl a L+r VIMSS34490 104 IELElstraDGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHR 162 88887655559********************7667**********************98 PP
Or compare VIMSS34490 to CDD or PaperBLAST