VIMSS536769 has 161 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-54 169.3 0.0 3.7e-54 169.1 0.0 1.0 1 VIMSS536769 Domain annotation for each sequence (and alignments): >> VIMSS536769 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.1 0.0 3.7e-54 3.7e-54 1 151 [] 8 159 .. 8 159 .. 0.94 Alignments for each domain: == domain 1 score: 169.1 bits; conditional E-value: 3.7e-54 THAP4_heme-bd 1 elgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkee.. 94 +l++la+LlGtW+G+G+g+ypti++f+y ee++fsh gkpfl+Y ++t+ + +gkplh+EtGylr p+ g++el+lahp+G++e+e+G+++ + VIMSS536769 8 DLAALAPLLGTWTGRGSGKYPTIQPFDYLEEVTFSHVGKPFLAYAQKTRAAADGKPLHAETGYLR-VPQPGRLELVLAHPSGITEIEVGSYAVTgg 102 5899*************************************************************.7************************97744 PP THAP4_heme-bd 95 kktlelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++ +++++i+ t++akevta+ r +++ ++L+y+v+m avg+plq hl a L+r VIMSS536769 103 LIEMRMSTTSIGLTPSAKEVTALARWFRIDGDELSYSVQMGAVGQPLQDHLAAVLHR 159 44566669*********************7667**********************98 PP
Or compare VIMSS536769 to CDD or PaperBLAST