VIMSS81707 has 161 amino acids
Query: THAP4_heme-bd [M=151] Accession: PF08768.15 Description: THAP4-like, heme-binding beta-barrel domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-49 154.4 0.0 1.4e-49 154.3 0.0 1.0 1 VIMSS81707 Domain annotation for each sequence (and alignments): >> VIMSS81707 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 154.3 0.0 1.4e-49 1.4e-49 1 151 [] 8 159 .. 8 159 .. 0.95 Alignments for each domain: == domain 1 score: 154.3 bits; conditional E-value: 1.4e-49 THAP4_heme-bd 1 elgplawLlGtWeGeGegeyptieefeygeeiefshdgkpflnYesrtwrldegkplhrEtGylrlepgtgevelllahptGvveleeGevkee.. 94 +l++la+LlG+W G+G g+ypti++fey ee++fsh +pfl+Y+++t+ +++gkplh+EtGylr p+ g++el+lah + ++e+e+G+++ + VIMSS81707 8 DLQALAPLLGSWVGRGMGKYPTIQPFEYLEEVVFSHLDRPFLTYTQKTRAITDGKPLHAETGYLR-VPQPGHIELVLAHHSDIAEIEVGTYSVTgd 102 589**************************************************************.7*************************7755 PP THAP4_heme-bd 95 kktlelesdaiartstakevtaakrlyglvdgdLeyavemaavgtplqehlsatLkr 151 ++el +++i+ +tak+vta+ r +++ ++++y+v+m avg+plq hl a L+r VIMSS81707 103 LIEVELVTTTIGLVPTAKQVTALGRFFRIDGDEFAYSVQMGAVGQPLQDHLVAVLHR 159 56788889*********************7667**********************98 PP
Or compare VIMSS81707 to CDD or PaperBLAST