PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2061415 to PF08878 (DUF1837)

VIMSS2061415 has 311 amino acids

Query:       DUF1837  [M=231]
Accession:   PF08878.11
Description: Domain of unknown function (DUF1837)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.7e-65  205.7  10.8    6.2e-65  205.3  10.8    1.2  1  VIMSS2061415  


Domain annotation for each sequence (and alignments):
>> VIMSS2061415  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.3  10.8   6.2e-65   6.2e-65       2     231 .]      37     288 ..      36     288 .. 0.95

  Alignments for each domain:
  == domain 1  score: 205.3 bits;  conditional E-value: 6.2e-65
       DUF1837   2 elaeflfnniveyalsreeieklakeeyselseeeaakkfrk....................dknlksGelGEllLylllehflkapkllsKmelkt 78 
                    + e++fn+i+ +al+r++ +++++e+ +e ++ +  k++++                    dk+lk+Ge+GEl+Ly+ll++ l++p+l+sK+++k+
  VIMSS2061415  37 GWIEEIFNSIPFFALGRDKAMEICEESPREAVR-QGLKLLYDikeireankeyltnpklkfdDKYLKRGEFGELILYYLLQEKLGKPQLISKLYFKD 132
                   689******************************.6666666666666666667778888888*********************************** PP

       DUF1837  79 ssnmevkgaDgvhikvdddgklqLwlGeSKlysdlksaideaveslkkflnedslnkelnlisnrlddedeelreaikklldpstslddknvrlnfv 175
                   s+n  v+g+D+vh+++ ++   +Lw+GeSK+y+d +sa+++++++l+k++n d++n+e+ +i++r+ d  + + ++i++l+dp+t+l +k +++n +
  VIMSS2061415 133 SYNSVVHGFDAVHFDKISK---ELWIGESKFYKDKNSALRDLADDLNKHFNIDFFNQEFTIIKRRFGDL-SVQDDDISSLVDPETKLLSKIININAC 225
                   ******************9...***********************************************.9************************** PP

       DUF1837 176 iligydsditkklke......esdeykdeikeeikkkvkaikk.eiskeklkkikihlflfPv 231
                   +++++ds+i ++++        s+e+ d +k+ ++k++ +++k +++ ++++k+kihlflfPv
  VIMSS2061415 226 FFALFDSKIVNSFSYesgtdnPSQEFLDVLKKAVEKTKFDFDKkISTYPYKDKLKIHLFLFPV 288
                   *************99****************************99*****************7 PP



Or compare VIMSS2061415 to CDD or PaperBLAST