PaperBLAST – Find papers about a protein or its homologs

 

Align WP_055648496.1 to PF08878 (DUF1837)

WP_055648496.1 has 291 amino acids

Query:       DUF1837  [M=231]
Accession:   PF08878.11
Description: Domain of unknown function (DUF1837)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      5e-18   51.8   0.0    6.7e-18   51.4   0.0    1.2  1  WP_055648496.1  


Domain annotation for each sequence (and alignments):
>> WP_055648496.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.4   0.0   6.7e-18   6.7e-18      19     188 ..      87     250 ..      61     271 .. 0.79

  Alignments for each domain:
  == domain 1  score: 51.4 bits;  conditional E-value: 6.7e-18
         DUF1837  19 eeieklakeeyselseeeaakkfrkdknlksGelGEllLylllehflkapkllsKmelktssnmevkgaDgvhikvdddgklqLwlGeSKlysd. 112
                     ++i++l+k  y+        ++f++++++++G+l E++L  ++    +a  ++ +++++ +  + +kg D++ ++    +   +++Ge+K+ +  
  WP_055648496.1  87 RKIASLKKLGYTID--DANVQRFPTHSDTQKGNLTEVFLAEYIVASSGANLPVYRLRYNPNVDQSMKGDDVLAFDFRGRKP-RIIIGEAKFRGVp 178
                     23444444444444..448899*99*****************************************************977.*********8874 PP

         DUF1837 113 lksaideaveslkkflnedslnkelnlisnrldde.deelreaikklldpstslddknvrlnfviligydsditkkl 188
                      k+a++++++ l+++  +  l   l+++ +rl ++ + +l+++++++     ++ + n +ln+v +++ + +   + 
  WP_055648496.1 179 SKAAVEDIIKGLNSS-YQGGLPASLQFVADRLYESgQNNLADQVESCAL---QIANGNLDLNYVGILLSNQNS-ANP 250
                     4677***********.999****************88899999999888...566699999999999999765.333 PP



Or compare WP_055648496.1 to CDD or PaperBLAST