E9PR95 has 76 amino acids
Query: DUF1907 [M=285]
Accession: PF08925.15
Description: Domain of Unknown Function (DUF1907)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.5e-26 77.6 0.1 6.1e-26 77.5 0.1 1.0 1 E9PR95
Domain annotation for each sequence (and alignments):
>> E9PR95
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.5 0.1 6.1e-26 6.1e-26 1 57 [. 20 76 .] 20 76 .] 0.96
Alignments for each domain:
== domain 1 score: 77.5 bits; conditional E-value: 6.1e-26
DUF1907 1 lqkaLkknfeevsvsvvdcPDLrkaPfklaaeglcgkeriadvGgvpyLlPlvkldk 57
+qk+Lk+nf++v+vsvvdcPDL+k+Pf++ +g+cgk+ria+vGgvpyLlPlv+++k
E9PR95 20 MQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKK 76
689*************************************************99765 PP
Or compare E9PR95 to CDD or PaperBLAST