biolip::1e8eA has 124 amino acids
Query: DUF1924 [M=96] Accession: PF09086.15 Description: Domain of unknown function (DUF1924) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-39 118.0 0.0 1.2e-38 117.7 0.0 1.1 1 biolip::1e8eA Domain annotation for each sequence (and alignments): >> biolip::1e8eA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 117.7 0.0 1.2e-38 1.2e-38 5 96 .] 25 116 .. 21 116 .. 0.97 Alignments for each domain: == domain 1 score: 117.7 bits; conditional E-value: 1.2e-38 DUF1924 5 efsaerGkalftkkvktkkgkelsCasCHgedptkegkhaktgkaieplapsvnpkrftdaakvekwfkrnckdvlgreCtaqekadllayl 96 ++s+++Gk +f++k kt +gke++CasCH+++p++ gk++ tgk+i plap vn+krftd++kve f+++c+d+lg +C+++eka+++ayl biolip::1e8eA 25 APSITDGKIFFNRKFKTPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDILGADCSPSEKANFIAYL 116 67899**************************************************************************************8 PP
Or compare biolip::1e8eA to CDD or PaperBLAST