biolip::1e8eA has 124 amino acids
Query: DUF1924 [M=96]
Accession: PF09086.15
Description: Domain of unknown function (DUF1924)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-39 118.0 0.0 1.2e-38 117.7 0.0 1.1 1 biolip::1e8eA
Domain annotation for each sequence (and alignments):
>> biolip::1e8eA
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 117.7 0.0 1.2e-38 1.2e-38 5 96 .] 25 116 .. 21 116 .. 0.97
Alignments for each domain:
== domain 1 score: 117.7 bits; conditional E-value: 1.2e-38
DUF1924 5 efsaerGkalftkkvktkkgkelsCasCHgedptkegkhaktgkaieplapsvnpkrftdaakvekwfkrnckdvlgreCtaqekadllayl 96
++s+++Gk +f++k kt +gke++CasCH+++p++ gk++ tgk+i plap vn+krftd++kve f+++c+d+lg +C+++eka+++ayl
biolip::1e8eA 25 APSITDGKIFFNRKFKTPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDILGADCSPSEKANFIAYL 116
67899**************************************************************************************8 PP
Or compare biolip::1e8eA to CDD or PaperBLAST