G7SDH9 has 210 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-11 29.9 0.2 3.7e-11 29.1 0.2 1.5 1 G7SDH9
Domain annotation for each sequence (and alignments):
>> G7SDH9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.1 0.2 3.7e-11 3.7e-11 1 56 [] 139 194 .. 139 194 .. 0.97
Alignments for each domain:
== domain 1 score: 29.1 bits; conditional E-value: 3.7e-11
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
++++Yaq++ + ++ +++g++ d+++t+ V +++v++e +e+ + Lt++ +G+
G7SDH9 139 ISMSYAQYQEFANWRAEQGLEEFDTQFTTEVSTMIFVDKEFLEQTLASLTDFYHGK 194
5789************************************************9997 PP
Or compare G7SDH9 to CDD or PaperBLAST