P27862 has 204 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-19 54.6 0.0 8.4e-19 53.6 0.0 1.5 1 P27862
Domain annotation for each sequence (and alignments):
>> P27862
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 53.6 0.0 8.4e-19 8.4e-19 1 55 [. 141 195 .. 141 196 .. 0.98
Alignments for each domain:
== domain 1 score: 53.6 bits; conditional E-value: 8.4e-19
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsG 55
l+c+Y ql +++lL+q +++i +++Y++ V l+v++p+++v++f+++L+++++G
P27862 141 LQCEYHQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRG 195
79****************************************************9 PP
Or compare P27862 to CDD or PaperBLAST