VIMSS40090 has 217 amino acids
Query: DUF1949 [M=56] Accession: PF09186.15 Description: Domain of unknown function (DUF1949) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-23 67.2 0.2 4.7e-23 67.2 0.2 1.9 2 VIMSS40090 Domain annotation for each sequence (and alignments): >> VIMSS40090 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.2 0.18 0.18 39 49 .. 33 43 .. 32 44 .. 0.84 2 ! 67.2 0.2 4.7e-23 4.7e-23 3 56 .] 142 195 .. 140 195 .. 0.98 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.18 DUF1949 39 eeeveafkqaL 49 e+e+++f+q++ VIMSS40090 33 EQEAQEFIQKI 43 678999*9998 PP == domain 2 score: 67.2 bits; conditional E-value: 4.7e-23 DUF1949 3 cdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56 dY++lgk++++L+++++ +++++Y+++V+++ +v+e e af++++telt+G+ VIMSS40090 142 ADYTWLGKIENELRESQFLLKEIHYSENVEFETYVEEKETNAFSEWMTELTNGK 195 7****************************************************7 PP
Or compare VIMSS40090 to CDD or PaperBLAST