VIMSS66211 has 213 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-22 63.6 0.2 1.2e-21 62.6 0.2 1.5 1 VIMSS66211
Domain annotation for each sequence (and alignments):
>> VIMSS66211
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.6 0.2 1.2e-21 1.2e-21 2 56 .] 141 195 .. 140 195 .. 0.98
Alignments for each domain:
== domain 1 score: 62.6 bits; conditional E-value: 1.2e-21
DUF1949 2 tcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
++dY +lgk++++L+q+++ +++++Y ++V + +v e+eve+ ++++t+lt+G+
VIMSS66211 141 SIDYHWLGKVENELRQSHYLLKEISYLENVDVQTYVLEAEVESYCEWMTNLTNGQ 195
69****************************************************8 PP
Or compare VIMSS66211 to CDD or PaperBLAST