TCDB::G7LAA5 has 207 amino acids
Query: DUF1990 [M=156] Accession: PF09348.14 Description: Domain of unknown function (DUF1990) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-45 139.8 0.0 5.2e-45 139.5 0.0 1.1 1 TCDB::G7LAA5 Domain annotation for each sequence (and alignments): >> TCDB::G7LAA5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 139.5 0.0 5.2e-45 5.2e-45 10 154 .. 45 195 .. 31 197 .. 0.94 Alignments for each domain: == domain 1 score: 139.5 bits; conditional E-value: 5.2e-45 DUF1990 10 gelP.agyrvlrarvrlGegeevferAaeallswrmqrragvrvrasapraapgat..vvvr.lglgplrlsapcrVvyvvd......epdrfGFaY 96 + lP +g+ ++arv +G+g e+fe+ ++al+swr++ +++ v++++ ++++ga+ v+v+ ++++ + +p++Vvyv + + + fGF+ TCDB::G7LAA5 45 KGLPnDGFLLNNARVLVGSGVETFEKGKSALRSWRHFGMNWAFVDPKT-PVEQGAKfcVCVKeFLPWLM---MPLQVVYVNEtsttknRGASFGFGS 137 5588789***************************************99.7******9999999999999...*************999999****** PP DUF1990 97 gTLpgHpesGeerFvVeldedgrVwfevtAFSrpatwlarlggPvvrllQrrfarryl 154 gTL+gH+ +GeerF+Ve+de+++Vw+e+ +FS+pa++l+ +g+P+v l Q+ fa++++ TCDB::G7LAA5 138 GTLQGHLLAGEERFSVEIDENNQVWYEILSFSKPAHVLSFVGYPYVMLRQKYFAHESA 195 *******************************************************987 PP
Or compare TCDB::G7LAA5 to CDD or PaperBLAST