VIMSS10088562 has 205 amino acids
Query: DUF1990 [M=156] Accession: PF09348.14 Description: Domain of unknown function (DUF1990) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-45 139.4 0.0 7e-45 139.1 0.0 1.1 1 VIMSS10088562 Domain annotation for each sequence (and alignments): >> VIMSS10088562 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 139.1 0.0 7e-45 7e-45 14 155 .. 50 196 .. 39 197 .. 0.96 Alignments for each domain: == domain 1 score: 139.1 bits; conditional E-value: 7e-45 DUF1990 14 agyrvlrarvrlGegeevferAaeallswrmqrragvrvrasapraapgat..vvvr.lglgplrlsapcrVvyvvd......epdrfGFaYgTLp 100 +g+ +++arv +G+g+e++e+ ++al++w+++ +++ v++ + +++ g++ ++v+ ++++++ +p++Vvyv + +p++fG++ gTL+ VIMSS10088562 50 DGFLINHARVLVGSGRESYEKGKKALQNWKHFGMDWAFVDPAT-PVETGKKfcICVKeVLPWVM---LPLQVVYVDEsrksrkGPAHFGYGSGTLQ 141 68999************************************99.7******9999999999999...*********9******************* PP DUF1990 101 gHpesGeerFvVeldedgrVwfevtAFSrpatwlarlggPvvrllQrrfarrylr 155 gH+ +Gee+F++eld +g+Vw+e+t+FS+pa+ l+ lg+P+v+l Q++far++ + VIMSS10088562 142 GHLLAGEEKFSIELDGNGEVWYEITSFSKPAHFLSFLGYPYVKLRQKHFARHSSE 196 ***************************************************9875 PP
Or compare VIMSS10088562 to CDD or PaperBLAST