VIMSS5916681 has 158 amino acids
Query: DUF1990 [M=156] Accession: PF09348.14 Description: Domain of unknown function (DUF1990) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-41 125.6 0.2 1.5e-40 125.0 0.2 1.3 1 VIMSS5916681 Domain annotation for each sequence (and alignments): >> VIMSS5916681 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 125.0 0.2 1.5e-40 1.5e-40 12 155 .. 21 154 .. 10 155 .. 0.93 Alignments for each domain: == domain 1 score: 125.0 bits; conditional E-value: 1.5e-40 DUF1990 12 lPagyrvlrarvrlGegeevferAaeallswrmqrragvrvrasapraapgatvvvrlglgplrlsapcrVvyvvdepdrfGFaYgTLpgHpesGee 108 +g+++++++ +lG gee+f++A+++l+sw+++++ag++v s++ v+++++ +++ crV + ++++r+ YgTL+ H+e+Gee VIMSS5916681 21 ASKGWQITDRKLVLGYGEECFQNAVQQLFSWEAHQHAGITVTESDS------IVELKFW----SIRSYCRVLKSHQGSRRAILIYGTLEKHVERGEE 107 568***************************************9993......4555555....6699****************************** PP DUF1990 109 rFvVeldedgrVwfevtAFSrpatwlarlggPvvrllQrrfarrylr 155 +F+++++++++V++++ AFS+pa+w+a+l++Pvvrl+Q r++++yl+ VIMSS5916681 108 AFEITMADNDQVTAHIVAFSKPAKWWAKLANPVVRLVQLRITDKYLE 154 ********************************************985 PP
Or compare VIMSS5916681 to CDD or PaperBLAST