VIMSS3630382 has 69 amino acids
Query: DUF2387 [M=72]
Accession: PF09526.14
Description: Probable metal-binding protein (DUF2387)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-19 55.8 0.4 2.1e-19 55.7 0.4 1.2 1 VIMSS3630382
Domain annotation for each sequence (and alignments):
>> VIMSS3630382
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 55.7 0.4 2.1e-19 2.1e-19 1 45 [. 1 45 [. 1 62 [. 0.91
Alignments for each domain:
== domain 1 score: 55.7 bits; conditional E-value: 2.1e-19
DUF2387 1 ikKRFiAGAVCPaCseqDklvmykedeveirECvaCgfvdklnek 45
+kKRFiAGA CP+C D++vm e e EC++Cg+++++ ++
VIMSS3630382 1 MKKRFIAGAKCPKCEAIDRIVMLTTAEDEWIECIECGYSENRPTH 45
79*************************************998655 PP
Or compare VIMSS3630382 to CDD or PaperBLAST