VIMSS1748361 has 345 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-71 227.3 0.3 2.3e-71 226.6 0.3 1.3 1 VIMSS1748361 Domain annotation for each sequence (and alignments): >> VIMSS1748361 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 226.6 0.3 2.3e-71 2.3e-71 1 228 [. 22 254 .. 22 256 .. 0.97 Alignments for each domain: == domain 1 score: 226.6 bits; conditional E-value: 2.3e-71 MPAB_Lcp_cat 1 wrvhgderilllgglralllqalhplvgaGvadhsrf.adplgRlrrTltyvatvtygtgeeaealaerVrrlHarvrgtddsgrrygaldpelllw 96 w+++gd r+ +lg ++ +++q++ p +gaGv++hs + ++pl+R++r+++++++v+y+ g++a +++++++ +H+ ++g+d+sgrry+al+pe+++w VIMSS1748361 22 WKYFGDLRTGMLG-VWIGAIQNMYPELGAGVEEHSILlREPLQRVARSVYPIMGVVYD-GDRAPETGAQIKGFHKTIKGVDSSGRRYHALNPETFYW 116 9***********9.99*******************99666******************.999*********************************** PP MPAB_Lcp_cat 97 vhatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddl......rklpaplrillar 187 +hat+++ +++++e+f+g lt+ae++++++e+++++r++g+++r+vp+t++ef++ywda +r+ele++ ++ ++++ +p+p++ +l++ VIMSS1748361 117 AHATFFMLIIKTAEYFCGGLTEAEKRQLFDEHVQWYRMYGMSMRPVPQTWEEFQDYWDAKCRDELEINRATLDIFSIRipkpwfVLMPTPIWDQLFK 213 **************************************************************************77669999998888889988*** PP MPAB_Lcp_cat 188 plgrllraltvgllpprlrellglpwtarderrlrrlarlv 228 pl + +r++++gl +p +re+ g++wt+ de+ lr ++++v VIMSS1748361 214 PLVGAQRWIAAGLFDPVVREKAGMRWTPGDEVLLRIFGKAV 254 ***********************************999887 PP
Or compare VIMSS1748361 to CDD or PaperBLAST