VIMSS3346230 has 454 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-15 41.9 7.1 6.1e-15 41.9 7.1 2.7 3 VIMSS3346230 Domain annotation for each sequence (and alignments): >> VIMSS3346230 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.3 0.8 0.0079 0.0079 139 178 .. 35 87 .. 17 114 .. 0.72 2 ! 41.9 7.1 6.1e-15 6.1e-15 27 175 .. 164 329 .. 148 381 .. 0.76 3 ? -0.7 0.1 0.065 0.065 90 123 .. 367 401 .. 354 412 .. 0.79 Alignments for each domain: == domain 1 score: 2.3 bits; conditional E-value: 0.0079 MPAB_Lcp_cat 139 prdvpatraefeaywdamlrpelevtpearellddl..............rklp 178 + ++ ++r++ + w ++ + ++ t+++r l+d+l rk+p VIMSS3346230 35 DSMWTQSRRDILEPWMDF-HEVPRETDRTRLLADHLwqgdelmdavvdriRKMP 87 678999999999999999.49999999999999999988866655544443333 PP == domain 2 score: 41.9 bits; conditional E-value: 6.1e-15 MPAB_Lcp_cat 27 vgaGvadhsrf.adplgRlrrTltyvatvtygt....geeaealaerVrrlHarvrgtddsg......rryg.aldpelllwvhatlvdsfl...da 108 v++++ +rf d l+R +T++++ +ty + ++ + ++ Vr++Ha+vr+ ++ +++g +++ ++ +++t+ + VIMSS3346230 164 VAYATGATGRFvNDTLRRNLETTAWFRKMTYRGalerYAQPFKDTVLVRLMHAQVRAGLRRSwgneqfAHHGnPISNSMMMGAAMTFGLIPPlidHQ 260 677778889**888*****************98666655577789***********99844456778888889**********99976555446777 PP MPAB_Lcp_cat 109 yerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddl.....r 175 ++r t+a+ ++++ w++++ +gv ++ +p+++ e + +d m++ +++ + ++ + VIMSS3346230 261 HGRT---RTQADLQAAVMYWAYIAYIFGVAEELIPTSVSEGMETMDYMVAYAGGPSEWTDIMMGAAfgfvdK 329 7777...9*********************88888***************99999999888875555555543 PP == domain 3 score: -0.7 bits; conditional E-value: 0.065 MPAB_Lcp_cat 90 dpelllwvhatlvdsfldayerf.vgpltdaeaer 123 d l+ w+ +t+++++ ++ r+ + +l+ a +++ VIMSS3346230 367 DARLQPWTTLTGIAVHANVTLRRvGDKLPGAARRA 401 67899999999999999666655477788888776 PP
Or compare VIMSS3346230 to CDD or PaperBLAST