VIMSS539144 has 351 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-79 252.3 12.7 4.3e-79 251.8 12.7 1.2 1 VIMSS539144 Domain annotation for each sequence (and alignments): >> VIMSS539144 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 251.8 12.7 4.3e-79 4.3e-79 1 228 [. 59 293 .. 59 295 .. 0.98 Alignments for each domain: == domain 1 score: 251.8 bits; conditional E-value: 4.3e-79 MPAB_Lcp_cat 1 wrvhgderilllgglralllqalhplvgaGvadhsrfad.plgRlrrTltyvatvtygtgeeaealaerVrrlHarvrgtddsgrrygaldpelllw 96 wr++gd+r +l g ++a+ +q++hp++ga+v+dhs+f++ + Rl r+l+++ +v+++ g++a ++++Vr++H ++g+d +grry+al+p++++w VIMSS539144 59 WRYFGDWRGMLQG-PWAGSMQNMHPQLGAAVEDHSTFFRgRWPRLLRSLYPIGGVVFD-GDRAPVTGVQVRDYHITIKGVDGAGRRYHALNPDVFYW 153 ***********99.***********************888******************.999*******************99************** PP MPAB_Lcp_cat 97 vhatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddl........rklpaplrill 185 +hat++ ++l+++erf+g lt+a+++++++e+++++r++g+++r+vpat++ef++ywd+m+r+ le + +ar++ld +++p++l+ + VIMSS539144 154 AHATFFVGTLHVAERFCGGLTEAQRRQLFDEHVQWYRMYGMSMRPVPATWEEFQDYWDHMCRNVLENNFAARAVLDLTelpkppfaQRVPDWLWAAP 250 **************************************************************************8888******************* PP MPAB_Lcp_cat 186 arplgrllraltvgllpprlrellglpwtarderrlrrlarlv 228 +++l+r++ +ltvgl++p +rel+g++w +rde+ +rr++ +v VIMSS539144 251 RKLLARFFVWLTVGLYDPPVRELMGYRWLRRDEWLHRRFGDIV 293 **************************************99877 PP
Or compare VIMSS539144 to CDD or PaperBLAST