WP_127552599.1 has 404 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-16 44.6 2.1 9.2e-16 44.6 2.1 2.1 2 WP_127552599.1 Domain annotation for each sequence (and alignments): >> WP_127552599.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.1 0.056 0.056 7 42 .. 7 47 .. 2 58 .. 0.66 2 ! 44.6 2.1 9.2e-16 9.2e-16 11 214 .. 125 339 .. 118 356 .. 0.75 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.056 MPAB_Lcp_cat 7 erilllgglralllqalhplvgaG......vadhsrfadplg 42 +r+l lg++ +l+ a+ p +++G +a +++dp++ WP_127552599.1 7 RRVLTLGAALGLAG-AAAPSAAWGwssagsIAGTDTITDPWK 47 45555665555555.999999999665555444445566775 PP == domain 2 score: 44.6 bits; conditional E-value: 9.2e-16 MPAB_Lcp_cat 11 ll.gglralllqalhplvgaGvadhsrf.adplgRlrrTltyvatvtygt....geeaealaerVrrlHarvrgtddsg.........rrygald 90 +l gl +++ ++ p+ ++ v s a + R++ T+ty + + + ++ + r+ Ha+vr+ ++ + + +++ WP_127552599.1 125 FLlYGLGSGIMSTVVPREARNVY-WSEGgAVMKSRAAKTFTYGYDLSALDafqpSGGFVVTSNKTRLTHAAVRHLLPQSakwravtddTDFIPIS 218 33366888888899999999888.4544366999********99998844444433368999***********9875452344444445555666 PP MPAB_Lcp_cat 91 pelllwvhatlvdsfldayerfvgpltdaeaeryyaewrrvgrllgvpprdvpatraefeaywdamlrpelevtpearellddlrklpaplrill 185 + l + tl + ++ ++ ++++ae+ +y+++w ++ +llgv+++ +pa++a+++ + +l+p + +tpe l+d l +l a + WP_127552599.1 219 NGDILVTFHTLGTYVYGKLKQWGIRMSAAEEAAYLHQWQVALHLLGVRDDFIPASWAAAKSQSAYVLTPLMGPTPEGINLADILLNLVAEVD--- 310 6666666666555555555555445**********************99999****************************888855555555... PP MPAB_Lcp_cat 186 arplgrllraltvgllpprlrellglpwt 214 + + ++++r +++ +l +++ + l lp + WP_127552599.1 311 LGVTRGFQREFARYVLSDKIGDWLKLPRD 339 57999999999999999999999999843 PP
Or compare WP_127552599.1 to CDD or PaperBLAST