XP_012227317.1 has 344 amino acids
Query: MPAB_Lcp_cat [M=230] Accession: PF09995.13 Description: ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-09 24.1 0.0 2.4e-09 23.7 0.0 1.2 1 XP_012227317.1 Domain annotation for each sequence (and alignments): >> XP_012227317.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.7 0.0 2.4e-09 2.4e-09 24 140 .. 77 199 .. 57 234 .. 0.77 Alignments for each domain: == domain 1 score: 23.7 bits; conditional E-value: 2.4e-09 MPAB_Lcp_cat 24 hplvgaG...vadhsrfadplgRlrrTltyvatvtygt....geeaealaerVrrlHarvrgtddsgrrygaldpelllwvhatlvdsfl...da 108 p v++ + +h+++ ++++R+ +Tl ++ t++ + + +++ +r H+ ++ ++++ ga+++++++ + + + +l + XP_012227317.1 77 LPDVLKVliyTKQHNTVCSAYKRYLETLLHIHTLFMCNpndpNSKWYKSMNLIRWKHRIS-SKKSKNANLGAIQQKDMVLTQFGFAAFLLiadES 170 4555554333569999999**************999553332444566666666666655.5566799******************999977777 PP MPAB_Lcp_cat 109 yerfvgpltdaeaeryyaewrrvgrllgvppr 140 +++ t++e+e++ + wr+ g +lg+++r XP_012227317.1 171 LGLH---CTPEEREAFNHFWRVNGYMLGISDR 199 7777...**********************887 PP
Or compare XP_012227317.1 to CDD or PaperBLAST