VIMSS56131 has 195 amino acids
Query: DUF2238 [M=140] Accession: PF09997.13 Description: Predicted membrane protein (DUF2238) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-56 176.8 5.8 1.8e-56 176.1 5.8 1.3 1 VIMSS56131 Domain annotation for each sequence (and alignments): >> VIMSS56131 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 176.1 5.8 1.8e-56 1.8e-56 2 139 .. 40 176 .. 39 177 .. 0.98 Alignments for each domain: == domain 1 score: 176.1 bits; conditional E-value: 1.8e-56 DUF2238 2 illlllvltyrrfrlsnlayllillflllllvGghYtYaevPlddwlkelfglernkYDrlvhfaqGlllalvarelllrkealrkw.llllavlvvla 99 ++l+ ++++ r+++s++ay+l++++l+l+++G++Yt+aevP+d w+++l+g++rn++Dr++hf++Gl+ a++++e+llrk++++ w ++ +a++ +++ VIMSS56131 40 LVLATIWWVSLRWSMSTTAYVLMFVWLCLHTIGAKYTFAEVPFD-WFNTLIGSTRNQFDRVAHFSIGLY-AYPIAEWLLRKQQTKPWlAYSFALFSLMS 136 688999**************************************.************************.**************9987999******** PP DUF2238 100 isalYEliEwavalllggeaaeaflGtqGdiWDaqkDmll 139 ++a+YE+iEw++a+l+gge++ aflG+qGdiWDaqkDml+ VIMSS56131 137 LAAAYEIIEWWYAALAGGEEGIAFLGSQGDIWDAQKDMLC 176 **************************************98 PP
Or compare VIMSS56131 to CDD or PaperBLAST