VIMSS142888 has 188 amino acids
Query: Phage_Mu_Gp48 [M=150] Accession: PF10076.13 Description: Bacteriophage Mu-like, Gp48 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-25 74.7 0.0 4.4e-25 74.4 0.0 1.0 1 VIMSS142888 Domain annotation for each sequence (and alignments): >> VIMSS142888 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.4 0.0 4.4e-25 4.4e-25 6 150 .] 10 185 .. 5 185 .. 0.95 Alignments for each domain: == domain 1 score: 74.4 bits; conditional E-value: 4.4e-25 Phage_Mu_Gp48 6 llPpglqesrelqalleaeakeldrveasaddllkeqfpetatwlLpdWEkilglpddssetleeRRaavlaklsekgglsiayleklaasllGee 101 + Pp++++ +a ++aea +d v a+ + + fp+ + L +WE+ l++++++ ++ ++R +avlakl++ gglsiay++ +a+s+ G+ VIMSS142888 10 MRPPVSYDTVGETAEIKAEAGVFDIVADHAEGVKNAPFPDAENDYLYRWEELLAITPPAGANTQQRTDAVLAKLNALGGLSIAYFTAIAESA-GY- 103 558888888888999*****************************************************************************.*9. PP Phage_Mu_Gp48 102 eieItenk.................erYilqVkvp...........gasgagenlea.....lecelerikPahtdvilaya 150 +++I e + + + V+++ g+s+ag++++ +e+++e++kPa t+ +++y+ VIMSS142888 104 TVTIYEEDqfragescagdclntedAIWRWCVDIAdgkatayifraGQSRAGDRISVytdpiIETMFEELKPAWTYCRFEYE 185 ****99999****************99999999999999*******9999999999899********************995 PP
Or compare VIMSS142888 to CDD or PaperBLAST