VIMSS3373792 has 232 amino acids
Query: Phage_Mu_Gp48 [M=150] Accession: PF10076.13 Description: Bacteriophage Mu-like, Gp48 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-27 80.3 0.0 9.6e-27 79.8 0.0 1.1 1 VIMSS3373792 Domain annotation for each sequence (and alignments): >> VIMSS3373792 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.8 0.0 9.6e-27 9.6e-27 14 144 .. 13 141 .. 2 145 .. 0.90 Alignments for each domain: == domain 1 score: 79.8 bits; conditional E-value: 9.6e-27 Phage_Mu_Gp48 14 srelqalleaeakeldrveasaddllkeqfpetatwlLpdWEkilglpddssetleeRRaavlaklsekgglsiayleklaasllGeeeieItenk 109 ++++++ a+++el+ +++++dd +++f++tatw+L+ WE+il + +++ +++ RR+ ++ak++++g+ +i+ ++++ +++++ e +I+ + VIMSS3373792 13 NYIVEEIQGAYDTELNILKEDIDDTFNQLFVDTATWGLDMWEDILCIEKKEL-DFDTRRSNIKAKMRSRGTSTIEVIKSICEAYTKS-ETDIKVYS 106 457889999*************************************987655.8******************************996.******** PP Phage_Mu_Gp48 110 erYilqVkvpgasgagenlealecelerikPahtd 144 +++++ +++ ++ + + l + +++er+kPah VIMSS3373792 107 DEFTFVLSFIANNCDYKTLLDCSDMIERVKPAHLL 141 **********9999999999*************43 PP
Or compare VIMSS3373792 to CDD or PaperBLAST