VIMSS3674196 has 208 amino acids
Query: Phage_Mu_Gp48 [M=150] Accession: PF10076.13 Description: Bacteriophage Mu-like, Gp48 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-25 73.5 0.2 1.2e-24 73.1 0.2 1.1 1 VIMSS3674196 Domain annotation for each sequence (and alignments): >> VIMSS3674196 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.1 0.2 1.2e-24 1.2e-24 2 142 .. 4 144 .. 3 152 .. 0.91 Alignments for each domain: == domain 1 score: 73.1 bits; conditional E-value: 1.2e-24 Phage_Mu_Gp48 2 ellallPpglqesrelqalleaeakeldrveasaddllkeqfpetat.wlLpdWEkilglpd.dssetleeRRaavlaklsekgglsiayleklaa 95 +l++ lPp +++e+++++++e+ el+ e+ +++lke f++tat +++ E+ +++ ++tle R+ +++++ +k++++ ++le ++ VIMSS3674196 4 KLINFLPPQISDIEEFKNIMATENVELELIEKGQERILKENFIDTATdYGIKHKEQLFKIRAdLVNDTLEFRKLRIKNRKMDKMPITQRSLEHKLK 99 799*********************************************************9956678***************************** PP Phage_Mu_Gp48 96 sllGeeeieItenkerYilqVkvpgasgagenlealecelerikPah 142 +l Ge++++++ +++Y l+V+++ + + ++ + ++ i P++ VIMSS3674196 100 TLFGEGNYKVEVLNDEYVLKVEIN--TFDWSMFNEIIDNFRYIIPCN 144 ************************..555555666666666666666 PP
Or compare VIMSS3674196 to CDD or PaperBLAST